PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0080089.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB
Protein Properties Length: 492aa    MW: 54725.3 Da    PI: 4.9998
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0080089.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.2e-194188148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ede+lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Lj0g3v0080089.1 41 KGPWTSAEDEILVDYVKKHGEGNWNAVQKHSGLARCGKSCRLRWANHL 88
                     79******************************************9986 PP

2Myb_DNA-binding52.11.5e-1694137146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++TteE+ +++++++++G++ W++ a++++ gRt++++k++w++
  Lj0g3v0080089.1  94 KGAFTTEEENRILELHAKMGNK-WARMAAELP-GRTDNEIKNYWNT 137
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0383688IPR017930Myb domain
SuperFamilySSF466892.13E-3038135IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-243891IPR009057Homeodomain-like
SMARTSM007178.7E-154090IPR001005SANT/Myb domain
PfamPF002492.9E-164188IPR001005SANT/Myb domain
CDDcd001672.79E-124388No hitNo description
PROSITE profilePS5129424.41789143IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2592141IPR009057Homeodomain-like
SMARTSM007171.5E-1593141IPR001005SANT/Myb domain
PfamPF002494.0E-1594137IPR001005SANT/Myb domain
CDDcd001673.13E-1196137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MSSTTTSGSE GQKVTKRRRS SLSAEEGSSG GNSTGEGRLK KGPWTSAEDE ILVDYVKKHG  60
EGNWNAVQKH SGLARCGKSC RLRWANHLRP DLKKGAFTTE EENRILELHA KMGNKWARMA  120
AELPGRTDNE IKNYWNTRIK RMQRAGLPLY PEEICRRVFT GNQENLNVGT LTNEATHHDD  180
LSQTDNNFVA PDVDFRNFKL RRDVLYEPSI FEMPENSVVE QNPDPSRGYI LLPMVHPSKQ  240
LPESDMMHTS LGSAAVFDQY GNHTYENTSD PPKLYGNYTC ENNSDSSLCD PVLSVSYQFH  300
GDNLVGSHAT NGNNSSSSAA VSGATKLELP SLQYFETQQG GWGRPAPQLP SLESVDTLIS  360
PPVELTTQSD PVSPESSGLL ESIIYHSKSL KVSNVDLQDT VPVETDKNLA SNPAKTEWNE  420
QLETHSPLGQ STSDYTPIRM CLVDEPQSVE TEHVHEADTA YSFSNKENLN QINISRPDAV  480
FDLGWFGNDM WQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30391415106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00279DAPTransfer from AT2G26960Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543825.20.0PREDICTED: transcription factor GAMYB-like isoform X1
RefseqXP_006593626.10.0PREDICTED: transcription factor GAMYB-like isoform X2
RefseqXP_006593627.10.0PREDICTED: transcription factor GAMYB-like isoform X2
RefseqXP_014620817.10.0PREDICTED: transcription factor GAMYB-like isoform X2
TrEMBLA0A0R0GJT20.0A0A0R0GJT2_SOYBN; Uncharacterized protein
TrEMBLK7LXA10.0K7LXA1_SOYBN; Uncharacterized protein
STRINGGLYMA13G04031.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.17e-77myb domain protein 81